A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10058
Swiss-prot Accession number	Q4FCM6 (Sequence in FASTA format)
Description	Bursicon precursor (Bursicon subunit alpha) (Cuticle-tanning hormone).
Source organism	Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Sphingoidea;Sphingidae; Sphinginae; Manduca.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Contains 1 CTCK (C-terminal cystine knot-like) domain.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading
Protein Length	156 Amino acids
Molecular weight	17659
References	1   Dewey E.M., Honegger H.-W.; "Identification of the Manduca sexta burs cDNA using RACE PCR."; Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	N/A
Hormone Name	Bursicon
Mature Hormone Sequence	QEVQLPPGQECQMTPVIHILKHRGCKPKAIPSFACIGKCTSYVQVSGSKIWQMERTCNCCQEAGEREATVVLYCPDAKNEERRFRKVSTKAPLECMCRPCGSIEESAIIPQEVAGYAEEGPLYNHFRKSF
Position of mature hormone in Pre-Hormone protein	130 Residues from position (27-156)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10482
Swiss-prot Accession number	P67788 (Sequence in FASTA format)
Description	Adipokinetic prohormone precursor [Contains: Adipokinetic hormone(AKH)].
Source organism	Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Sphingoidea;Sphingidae; Sphinginae; Manduca.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the AKH/HRTH/RPCH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	This hormone, released from cells in the corpora cardiaca after the beginning of flight, causes release of diglycerides from the fat body and then stimulates the flight muscles to use these diglycerides as an energy source
Protein Length	65 Amino acids
Molecular weight	7401
References	1  PubMed abstract 2753887 2  PubMed abstract 4074373
Domain Name	N/A
Hormone Name	Adipokinetic hormone
Mature Hormone Sequence	QLTFTSSWG
Position of mature hormone in Pre-Hormone protein	9 Residues from position (20-28)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	11400
Swiss-prot Accession number	P11919 (Sequence in FASTA format)
Description	Eclosion hormone precursor (Ecdysis activator) (EH).
Source organism	Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Sphingoidea;Sphingidae; Sphinginae; Manduca.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insect eclosion hormone family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Neuropeptide that triggers the performance of ecdysis behaviors at the end of a molt. It triggers adult behavior patterns: larval, pupal and adult ecdysis, and plasticization during the molt
Protein Length	88 Amino acids
Molecular weight	9675
References	1  PubMed abstract 2813382 2  PubMed abstract 3304284 3  PubMed abstract 3609300 4  PubMed abstract 1634328
Domain Name	Eclosion
Hormone Name	Eclosion hormone
Mature Hormone Sequence	NPAIATGYDPMEICIENCAQCKKMLGAWFEGPLCAESCIKFKGKLIPECEDFASIAPFLNKL
Position of mature hormone in Pre-Hormone protein	62 Residues from position (27-88)
Receptor	Q32XW8   Detail in HMRbase    Q32XW9    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 4

HMRbase accession number	11427
Swiss-prot Accession number	P21819 (Sequence in FASTA format)
Description	Diuretic hormone 1 precursor (DH-1) (Diuretic peptide 1) (DP-1) (Mas-DH).
Source organism	Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Sphingoidea;Sphingidae; Sphinginae; Manduca.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Regulation of fluid secretion
Protein Length	138 Amino acids
Molecular weight	15297
References	1  PubMed abstract 1279702 2  PubMed abstract 16594029
Domain Name	CRF
Hormone Name	Diuretic hormone 1
Mature Hormone Sequence	RMPSLSIDLPMSVLRQKLSLEKERKVHALRAAANRNFLNDI
Position of mature hormone in Pre-Hormone protein	41 Residues from position (81-121)
Receptor	P35464    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 5

HMRbase accession number	11431
Swiss-prot Accession number	P24858 (Sequence in FASTA format)
Description	Diuretic hormone 2 (DH-2) (Diuretic peptide 2) (DP-2) (DPII).
Source organism	Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Sphingoidea;Sphingidae; Sphinginae; Manduca.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Regulation of fluid secretion
Protein Length	30 Amino acids
Molecular weight	3561
References	1  PubMed abstract 1764106
Domain Name	CRF
Hormone Name	Diuretic hormone 2
Mature Hormone Sequence	SFSVNPAVDILQHRYMEKVAQNNRNFLNRV
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	P35464    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments